PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G40030.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 261aa    MW: 28844.2 Da    PI: 6.5998
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G40030.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB152.21e-4733115284
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 
                      +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++
  OMERI01G40030.2  33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMR 115
                      89*******************************************************************************97 PP

2NF-YB143.84e-45167258394
            NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       qd++lPianv+rimk  lP +akisk aket+qec++efisfvt+eas++c+re+rkt+ngdd+++a+ tlG+++y+++++ yl++yre e
  OMERI01G40030.2 167 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRKTVNGDDVCHAMRTLGLDHYADAMHRYLQRYREGE 258
                      69***************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.2E-4427115IPR009072Histone-fold
SuperFamilySSF471131.37E-3335116IPR009072Histone-fold
PfamPF008081.1E-2638101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.5E-156684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.5E-1585103No hitNo description
Gene3DG3DSA:1.10.20.104.0E-41164258IPR009072Histone-fold
SuperFamilySSF471132.64E-32168257IPR009072Histone-fold
PfamPF008088.7E-24172235IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PROSITE patternPS006850202218IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.5E-15237255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MADHHGDHHA DGHRRQQQLQ GEAADQAAAE IIKEQDRLLP IANVGRIMKQ ILPPNAKISK  60
EAKETMQECV SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDDY VDPMRSRDLN  120
FSGFNQLGRL QPMQGLPRAS SSSTSASRDR DGGDGDGGGG GVTMTNGQDN LLPIANVGRI  180
MKDGLPPQAK ISKRAKETIQ ECATEFISFV TGEASERCRR ERRKTVNGDD VCHAMRTLGL  240
DHYADAMHRY LQRYREGEEL A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-3732256192Transcription factor HapC (Eurofung)
4g92_B1e-3732256192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032460.0AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12.
GenBankAP0032660.0AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640197.11e-83PREDICTED: transcriptional activator hap3-like
SwissprotO822484e-49NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0E0CCP20.0A0A0E0CCP2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000170-PA1e-81(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-50nuclear factor Y, subunit B5